PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.F02896.1.p
Common NameEUGRSUZ_F02896, LOC104449751
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family G2-like
Protein Properties Length: 451aa    MW: 49408 Da    PI: 7.1964
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.F02896.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.84.4e-32264317255
           G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                       pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Eucgr.F02896.1.p 264 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 317
                       9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466892.69E-15261317IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.9E-28262317IPR009057Homeodomain-like
TIGRFAMsTIGR015571.1E-23264317IPR006447Myb domain, plants
PfamPF002498.3E-7265316IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009887Biological Processorgan morphogenesis
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0009956Biological Processradial pattern formation
GO:0010051Biological Processxylem and phloem pattern formation
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 451 aa     Download sequence    Send to blast
MPLEGVFIEH SSSPVPDLSL HISLPSASTP AASICHDING REESVDLWSK GEALKSSSNC  60
SVRVDSHAHT ELSLAHPANA AIGNENWCRM NFSVEAKDVL PNNPYQKGHN GGVSPVDVMD  120
STRPIKGIPI YQNRSFPFLP MENAREKDPK LCLPQVPYSS WSPSISPSSS CSSKAFHSPA  180
PYLGRSLNPF SILNSGTPDP SSSGYQIPAT GRFGGLSAYQ LHQYHHHHHH HSQYAVIGSS  240
EASHGMMRSR FVSKLPVKRS MRAPRMRWTS TLHARFVHAV ELLGGHERAT PKSVLELMDV  300
KDLTLAHVKS HLQMYRTVKT TDKPAASSGQ SDGSGDEDVS PMCNVSDHSS RRVTDQRKMI  360
EGSAHVDMDT PSSTILWSNS SSSRSEVCRR SNPTDDGDGL RQPPFHTHRR SLGVEGSDSM  420
ERLLLPTQSS QNPSLEFTLG RPDWQGEEDD *
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.F02896.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010062307.10.0PREDICTED: transcription repressor KAN1 isoform X1
TrEMBLA0A059BU050.0A0A059BU05_EUCGR; Uncharacterized protein
STRINGVIT_04s0043g00340.t011e-145(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM66062645
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.15e-56G2-like family protein